PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN47505.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 1039aa    MW: 114532 Da    PI: 5.426
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN47505.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28.2e-183783148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd+ l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
       KHN47505.1 37 KGQWTPEEDDTLRNAVERFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 83
                     799****************************9.************986 PP

2Myb_DNA-binding65.78.6e-2189135148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde+++++vk++G++ W+tIa++++ gR +kqc++rw ++l
       KHN47505.1  89 KGPWSKEEDEIIIELVKKHGPKKWSTIAQHLP-GRIGKQCRERWVNHL 135
                      79******************************.************996 PP

3Myb_DNA-binding46.96.4e-15141183145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l+++++ +G++ W+  ++ ++ gRt++ +k++w+
       KHN47505.1 141 KEAWTQEEELALIHYHQSFGNK-WAELSKVIP-GRTDNAIKNHWN 183
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2423283IPR017930Myb domain
SMARTSM007178.7E-153685IPR001005SANT/Myb domain
PfamPF002497.2E-163783IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-223895IPR009057Homeodomain-like
SuperFamilySSF466891.87E-153893IPR009057Homeodomain-like
CDDcd001671.70E-134083No hitNo description
PROSITE profilePS5129432.39784139IPR017930Myb domain
SuperFamilySSF466893.56E-3186182IPR009057Homeodomain-like
SMARTSM007171.6E-1988137IPR001005SANT/Myb domain
PfamPF002493.2E-1989135IPR001005SANT/Myb domain
CDDcd001672.33E-1791135No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2796142IPR009057Homeodomain-like
PROSITE profilePS5129419.492140190IPR017930Myb domain
SMARTSM007171.9E-14140188IPR001005SANT/Myb domain
PfamPF002492.1E-13141184IPR001005SANT/Myb domain
CDDcd001678.44E-11143183No hitNo description
Gene3DG3DSA:1.10.10.601.0E-21143190IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1039 aa     Download sequence    Send to blast
MDGEQSMAAP SHGQVDGAQK VRALHGRTTG PTRRSTKGQW TPEEDDTLRN AVERFKGKNW  60
KKIAECFKDR TDVQCLHRWQ KVLNPELVKG PWSKEEDEII IELVKKHGPK KWSTIAQHLP  120
GRIGKQCRER WVNHLDPTIK KEAWTQEEEL ALIHYHQSFG NKWAELSKVI PGRTDNAIKN  180
HWNSSVKKKL DSYLASGLLT QFESVPHAGN LNQPTRLQCS RDDNGPKSTE GEEVSDCSQG  240
SANAVYFPSA TGPSSVDLQT GEAYRPNEEC SLGKDHSPSR ACSEPYYVSI DDVTICIPEI  300
AHQEACTSQF IEQQSHEPGN SICGDCQFNL HSLPNVSSMV LGQESSELQR DFIAPCEICD  360
MVNAPFQTSV ELGVSTSMGP ASMDSLKPEH MLISDDECCR VLFSDAMNDG CFPRVDYNKR  420
DDIVEFSGCT SFCQSCNIQI SETGGTSTSQ LTCPQCSNNY KGISSSQSVP LVLSASDDRL  480
GPTANGNQLF GMEDHHFVSR ACANFTYVNN ISSSCVDGVG SAVMEEPHDI LKGTSKLVPV  540
NNFGCGSDAK QTCNPTAEKT NVHTEKEGSG SLCYEPPRFP SLDIPFFSCD LVQSGSDMQQ  600
EFSPLGIRQF MMSSMNCLTP FRLWDSPSCD DSPDALLKSA AKTFTGTPSI LKKRPRDLLS  660
PLSDKRMDKK LETDMASSTF TRNFSSLVAA FGDNETRKAD MPSYSYPLQK QNSRASVDDD  720
NKENCGHTYK WEQLMNCSPI KSATLDEKNS QRDTVDGNSQ HNVKQRPLDS KMKTTEIEQQ  780
QSGILVEHDM NDLSLSSPDQ VGLKSDRGLD SSAKITKGLN KSLEAASNQS GHLKLSSKNP  840
CPRVNSCSPC VRAKEHEGLS VAVTRVQAPG DNSGEQTRKD GGFETCSIFG GTPFGTPSAW  900
KSPWFFNTFL SSPRLDTEIT IEDFGYFMSP GDRSYDALGL LKHISEQTAA TYANAQEILG  960
NETPKALPKD ASENDKDKDH ENNYPVNQSG NHSQLPSNAL IERRTLDFSE CETPGRDENS  1020
KSSAMSFSSP SSYLMKGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-67371906159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-67371906159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003545596.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
TrEMBLA0A0B2SRH50.0A0A0B2SRH5_GLYSO; Myb-related protein 3R-1
STRINGGLYMA17G26240.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37273362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]